PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G150600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 558aa    MW: 61956.2 Da    PI: 6.1569
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G150600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.4e-1659105148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT++Ede l  av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
  Aqcoe2G150600.1.p  59 KGGWTPQEDETLRSAVEAFKGKCWKKIAEFFP-DRSEVQCLHRWQKVL 105
                        688*****************************.************986 PP

2Myb_DNA-binding61.81.4e-19111157148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT+eEd++++++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
  Aqcoe2G150600.1.p 111 KGPWTQEEDDKIIELVAKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 157
                        79******************************.*************97 PP

3Myb_DNA-binding52.21.4e-16163206146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +++WT eE++ l +a +++G++ W+ Ia+ ++ gRt++++k++w++
  Aqcoe2G150600.1.p 163 KDAWTLEEELSLMNAQREYGNK-WAEIAKVLP-GRTDNSIKNHWNS 206
                        679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.00754105IPR017930Myb domain
SuperFamilySSF466892.66E-1455112IPR009057Homeodomain-like
SMARTSM007172.4E-1458107IPR001005SANT/Myb domain
PfamPF002499.4E-1559105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1961111IPR009057Homeodomain-like
CDDcd001671.98E-1262105No hitNo description
PROSITE profilePS5129431.302106161IPR017930Myb domain
SuperFamilySSF466891.24E-31108204IPR009057Homeodomain-like
SMARTSM007176.3E-19110159IPR001005SANT/Myb domain
PfamPF002494.8E-19111157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-27112160IPR009057Homeodomain-like
CDDcd001672.35E-16113157No hitNo description
Gene3DG3DSA:1.10.10.608.0E-22161212IPR009057Homeodomain-like
SMARTSM007173.2E-15162210IPR001005SANT/Myb domain
PROSITE profilePS5129421.49162212IPR017930Myb domain
PfamPF002495.5E-15163206IPR001005SANT/Myb domain
CDDcd001671.22E-11165208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MTELKIQQIC LVNKQSEETS SSSFSEESYS IALKSPEITS PVTTSPSHRR TSGPIRRAKG  60
GWTPQEDETL RSAVEAFKGK CWKKIAEFFP DRSEVQCLHR WQKVLNPELI KGPWTQEEDD  120
KIIELVAKYG PTKWSVIAKS LPGRIGKQCR ERWHNHLNPM IKKDAWTLEE ELSLMNAQRE  180
YGNKWAEIAK VLPGRTDNSI KNHWNSSLKK KLDFFVATGR LPPVPTTGPN GAKDTCKTTA  240
AGQISACSSK VSDSTDEKCV ESEDLCKAEG DGKDRLEDLA LECLTDTATG VALIGSSRSD  300
DGQCTRASII RCTESVSTPN PVDIENTGGD DSDNKLDGSP VHSTIRTFGS LYYEPPQFEN  360
IDIPLSSALF DTNCSLHRIY SANSVTSPSG YATPPCVEDS NFGLRNAESI LRNAAKSFPN  420
TPSILRKRKT EAYVTLPQDG ILKGNEMKVL DSSNGLKEKE ISDQDRFVRR SEGEKLYQNP  480
AFHGNDTIEY CDGENFNTAP PYRIWSKRTS VYKSLEKQLD FTLDTQNFES QAQSSLVIKG  540
NQPFTESYSQ TAKMGVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-69582125159MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-69582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256935.10.0PREDICTED: myb-related protein B
RefseqXP_010256936.10.0PREDICTED: myb-related protein B
TrEMBLF6HLC50.0F6HLC5_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-138myb domain protein 3r-5